Antibodies

Jump to Filters
View as table Download
ISG15 Rabbit Polyclonal Antibody
TA342596

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ISG15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK
ISG15 Rabbit Polyclonal Antibody
TA377587

USD 365.00

3 Weeks

ISG15 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1).
Modifications Unmodified