ACTN3 (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ACTN3 antibody was raised against synthetic peptide - KLH conjugated |
ACTN3 (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ACTN3 antibody was raised against synthetic peptide - KLH conjugated |
Rabbit Polyclonal Anti-ACTN3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY |