Antibodies

Jump to Filters
View as table Download
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA802113

USD 447.00

In Stock

ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
CF802113

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]
TA802113AM

USD 509.00

5 Days

ZEB2 mouse monoclonal antibody,clone 1E12, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]
TA802113BM

USD 509.00

5 Days

ZEB2 mouse monoclonal antibody,clone 1E12, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA802113S

USD 200.00

In Stock

ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
AP01369PU-N

USD 465.00

3 Weeks

Smad Interacting Protein 1 (ZEB2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human SIP1.
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI15G8]
CF802108

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA312721

USD 380.00

In Stock

Rabbit polyclonal anti-ZEB2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZEB2.
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA349437

USD 380.00

In Stock

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZEB2
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA343754

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the middle region of human ZEB2. Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA334226

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the N terminal of human ZEB2. Synthetic peptide located within the following region: SETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEE