Antibodies

View as table Download

Rabbit Polyclonal Anti-FADS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FADS1

FADS1 mouse monoclonal antibody, clone 2D9, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-FADS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FADS1 antibody: synthetic peptide directed towards the C terminal of human FADS1. Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL