Antibodies

Jump to Filters
View as table Download
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA335174

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WT1 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA308577

USD 625.00

2 Weeks

Rabbit polyclonal antibody to WT1 (Wilms tumor 1)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 209 and 449 of Wilms Tumor 1 (Uniprot ID#P19544)