Antibodies

View as table Download

Rabbit anti-TP53 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications Dot, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Monkey, Rabbit)
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications Phospho-specific

Rabbit Polyclonal Anti-E2F3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3.

Rabbit Polyclonal Anti-E2F2 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2. Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI

Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166.
Modifications Phospho-specific

Rabbit anti p53 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human p53 protein

Rabbit anti P53(pS15) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein

Rabbit anti P53(pS37) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein

Rabbit polyclonal Retinoblastoma (Ser608) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Retinoblastoma around the phosphorylation site of serine 608 (Y-L-SP-P-V).
Modifications Phospho-specific

Phospho-RB1-S780 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S780 of human RB1
Modifications Phospho-specific