Antibodies

Jump to Filters
View as table Download
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]
TA505966

USD 447.00

In Stock

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]
CF505966

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
TA346659

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
Hsc70 (HSPA8) Goat Polyclonal Antibody
TA302666

USD 520.00

5 Days

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications IF, IHC, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
TA346660

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: BB70]
TA309384

USD 590.00

2 Weeks

Mouse Monoclonal anti-Hsc70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Bovine, Fish, Rabbit, Chicken, Xenopus, Drosophila, Yeast, Beluga, Hamster, Guinea Pig
Conjugation Unconjugated
SFRS3 (SRSF3) (C-term) Rabbit Polyclonal Antibody
AP31722PU-N

USD 535.00

2 Weeks

SFRS3 (SRSF3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide from Human SFRS3.
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]
TA505966S

USD 200.00

In Stock

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
U1A (SNRPA) Rabbit Polyclonal Antibody
TA345885

USD 539.00

5 Days

Rabbit Polyclonal Anti-SNRPA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPA antibody: synthetic peptide directed towards the middle region of human SNRPA. Synthetic peptide located within the following region: MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
SF2 (SRSF1) (C-term) Rabbit Polyclonal Antibody
AP17742PU-N

USD 580.00

2 Weeks

SF2 (SRSF1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 165~194 amino acids from the C-terminal region of Human SFRS1
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
TA332519

USD 365.00

2 Weeks

Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA8
SNRPD1 Rabbit Polyclonal Antibody
TA345991

USD 539.00

5 Days

Rabbit Polyclonal Anti-SNRPD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
LSM4 Rabbit Polyclonal Antibody
TA343783

USD 539.00

5 Days

Rabbit Polyclonal Anti-LSM4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK