Antibodies

Jump to Filters
View as table Download
ALDOB Rabbit Polyclonal Antibody
TA590002

USD 482.00

In Stock

Rabbit Polyclonal Aldolase B Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
PCK1 Rabbit Polyclonal Antibody
TA590679

USD 482.00

In Stock

Rabbit Polyclonal PCK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
CD38 Rabbit Polyclonal Antibody
TA324750

USD 580.00

2 Weeks

Rabbit polyclonal CD38 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38.
Adenylate Kinase 1 (AK1) Rabbit Polyclonal Antibody
TA590022

USD 482.00

In Stock

Rabbit Polyclonal Adenylate Kinase 1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
SPHK1 Rabbit Polyclonal Antibody
TA324909

USD 580.00

5 Days

Rabbit polyclonal SPHK1 Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen This SPHK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the Central region of human SPHK1.
Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody
TA324847

USD 580.00

5 Days

Rabbit polyclonal ENO1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus)
Conjugation Unconjugated
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.
CYP11B1 Rabbit Polyclonal Antibody
TA342857

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA301409

USD 550.00

In Stock

Rabbit Polyclonal Antibody against Aromatase

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human aromatase protein sequence (between residues 400-502).
GK2 Rabbit Polyclonal Antibody
TA308560

USD 625.00

5 Days

Rabbit Polyclonal antibody to Glycerol kinase 2 (glycerol kinase 2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Monkey, Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 67 and 338 of Glycerol kinase 2 (Uniprot ID#Q14410)
PKM2 (PKM) Rabbit Polyclonal Antibody
TA324317

USD 580.00

5 Days

Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2).
CYP21A2 Rabbit Polyclonal Antibody
TA342859

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP21A2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA
HSD3B2 Rabbit Polyclonal Antibody
TA334658

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
alpha Glucosidase II (GANAB) Rabbit Polyclonal Antibody
TA308533

USD 625.00

5 Days

Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Monkey, Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697)
ENPP3 Rabbit Polyclonal Antibody
TA316704

USD 515.00

5 Days

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Dog, Human, Monkey, Gibbon, Orang-Utan (Predicted: Bovine, Horse, Pig)
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%).
ENPP3 Rabbit Polyclonal Antibody
TA316706

USD 515.00

5 Days

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%).