Antibodies

View as table Download

THOC3 mouse monoclonal antibody,clone OTI4H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) THOC3 mouse monoclonal antibody,clone OTI4H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

THOC3 mouse monoclonal antibody,clone OTI4H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-THOC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3. Synthetic peptide located within the following region: PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT