Germany
Japan
United Kingdom
China
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
| Applications | FC, ICC/IF, IHC, IP, WB |
| Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | ChIP, ICC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
USD 550.00
In Stock
Rabbit Polyclonal Nhe-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nhe-1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of the human Nhe-1. The immunogen is located within the last 50 amino acids of Nhe-1. |
Rabbit Polyclonal Nhe-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nhe-1 antibody was raised against a 17 amino acid synthetic peptide near the center of the human Nhe-1. The immunogen is located within amino acids 490 - 540 of Nhe-1. |
Rabbit Polyclonal Anti-ATP1B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Feline, Rabbit, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Applications
- IHC
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Cardiac muscle contraction