Antibodies

View as table Download

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 296 of ZO-1 (Uniprot ID#Q07157)

TJP1 (alpha minus) guinea pig polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Human peptide antigen corresponding to ten residues at the splice junction.

TJP1 (alpha plus) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Amino acids 886-995 of Human ZO-1

TJP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TJP1

TJP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TJP1