Rabbit Polyclonal Anti-SLC6A8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC6A8 |
Rabbit Polyclonal Anti-SLC6A8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC6A8 |
Rabbit Polyclonal Anti-SLC6A8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC6A8 antibody: synthetic peptide directed towards the N terminal of human SLC6A8. Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC |