Rabbit Polyclonal antibody to NCS1 (neuronal calcium sensor 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 138 of NCS1 |
Rabbit Polyclonal Anti-NCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FREQ Antibody: synthetic peptide directed towards the N terminal of human FREQ. Synthetic peptide located within the following region: MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQK |
Germany
Japan
United Kingdom
China
