Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC25B |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC25B |
CDC25B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC25B |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
CDC25B pSer187 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S187 of human Cdc25B. |
CDC25B rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human CDC25B. |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS |
CDC25B rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 320-370 of Human Cdc25B. |