Antibodies

Jump to Filters
View as table Download
SHARP2 (BHLHE40) Rabbit Polyclonal Antibody
TA309587

USD 620.00

5 Days

Rabbit Polyclonal DEC1 Antibody

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DEC1 antibody maps to a region between residues 350 and the C-terminus (residue 412) of human Differentially Expressed in Chondrocytes NP_003661.1 (GeneID 8553).
SHARP2 (BHLHE40) Rabbit Polyclonal Antibody
TA334719

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-BHLHB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BHLHB2 antibody: synthetic peptide directed towards the middle region of human BHLHB2. Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE