Antibodies

View as table Download

Rabbit Polyclonal TLR2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2.

Rabbit Polyclonal TLR4 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal portion of the human TLR4 protein (between residues 650-710) [UniProt O00206]

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.

TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3.

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Rabbit Polyclonal anti-TLR2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

Rabbit Polyclonal TRIF/TICAM1 Antibody

Applications ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was developed against a synthetic peptide corresponding to amino acids 143-158 of mouse TRIF (NP_778154).

Rabbit Polyclonal TLR7 Antibody

Applications Dot, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was developed against KLH-conjugated synthetic peptide corresponding to amino acids 706-749 of human TLR7; GenBank no. gb|AAF78035.1|AF245702_1. It will cross-react with mouse TLR7. In human Ramos cells, additional bands are seen.

Rabbit Polyclonal c-Fos Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

TLR3 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR3 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal Antibody against PIK3CA (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA.

Rabbit Polyclonal Antibody against AKT2 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2.

Rabbit Polyclonal Antibody against CD14 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14.

Goat Polyclonal Antibody against AKT3

Applications FC, IHC, PEP-ELISA, WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CSPTSQIDNIGEEEM, from the internal region of the protein sequence according to NP_005456; NP_859029.

Rabbit Polyclonal MD-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MD-2 antibody was raised against a peptide corresponding to 13 amino acids near the center of human MD-2. The immunogen is located within the last 50 amino acids of MD-2.