Antibodies

View as table Download

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GBA mouse monoclonal antibody, clone OTI1D12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

Rabbit polyclonal GC Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse (Predicted: Bovine, Pig)
Conjugation Unconjugated
Immunogen This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC.

GBA mouse monoclonal antibody, clone OTI1D12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated