Antibodies

Jump to Filters
View as table Download
TJP1 Goat Polyclonal Antibody
AB0054-200

USD 355.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.
TJP1 Rabbit Polyclonal Antibody
TA341679

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS
PKC alpha (PRKCA) (pan) Rabbit Polyclonal Antibody
AP06566PU-N

USD 465.00

3 Weeks

PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan.
NKCC1 (SLC12A2) Rabbit Polyclonal Antibody
TA341288

USD 515.00

5 Days

Rabbit Polyclonal Anti-SLC12A2 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Bovine, Dog, Bat, Hamster, Panda, Horse, Pig (100%); Elephant, Lizard (94%); Opossum, Chicken (88%); Turkey (82%).