Antibodies

Jump to Filters
View as table Download
SLC2A6 Mouse Monoclonal Antibody [Clone ID: OTI7E3]
TA500639

USD 447.00

In Stock

Anti-SLC2A6 (GLUT6) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
SLC2A6 Mouse Monoclonal Antibody [Clone ID: OTI7E3]
CF500639

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) SLC2A6 mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
SLC2A6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E3]
TA500639AM

USD 509.00

2 Weeks

Anti-SLC2A6 (GLUT6) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3), Biotinylated

Applications IF, IHC, WB
Reactivities Human
Conjugation Biotin
SLC2A6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E3]
TA500639BM

USD 509.00

2 Weeks

Anti-SLC2A6 (GLUT6) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human
Conjugation HRP
SLC2A6 Rabbit Polyclonal Antibody
TA367467

USD 380.00

4 Weeks

SLC2A6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC2A6
SLC2A6 Rabbit Polyclonal Antibody
TA333771

USD 485.00

5 Days

Rabbit Polyclonal Anti-SLC2A6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A6 Antibody: synthetic peptide directed towards the C terminal of human SLC2A6. Synthetic peptide located within the following region: AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL