Antibodies

View as table Download

Rabbit Polyclonal Anti-APOBEC3G Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human APOBEC3G

APOBEC3G (C-term) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-Terminus of Human APOBEC3G (NP_068594.1).
Percent identity by BLAST analysis: Human, Baboon (100%); Monkey (92%); Chimpanzee, Gorilla, Gibbon, Marmoset (83%).

Goat Anti-APOBEC3G Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEHSQDLSGRLR, from the C Terminus of the protein sequence according to NP_068594.1.

APOBEC3G rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human APOBEC3G

APOBEC3G Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-330 of human APOBEC3G (NP_068594.1).
Modifications Unmodified

APOBEC3G (Center) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This polyclonal antibody is generated from mice immunized with KLH conjugated synthetic peptides corresponding to middle region of human CEM15.

APOBEC3G (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This polyclonal antibody is generated from mice immunized with KLH conjugated synthetic peptides corresponding to C-terminal of human CEM15.

Rabbit Polyclonal APOBEC3G Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen APOBEC3G antibody was raised against a synthetic peptide corresponding to 15 amino acids near the amino-terminus of human APOBEC3G APOBEC3G antibody will also detect the APOBEC3F isoform.

Rabbit Polyclonal Anti-APOBEC3G Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APOBEC3G Antibody: synthetic peptide directed towards the N terminal of human APOBEC3G. Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Goat Anti-APOBEC3G / ARP9 Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SKWRKLHRDQE, from the internal region of the protein sequence according to NP_068594.1