Rabbit Polyclonal Anti-APOBEC3G Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APOBEC3G |
Rabbit Polyclonal Anti-APOBEC3G Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APOBEC3G |
APOBEC3G (C-term) goat polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the C-Terminus of Human APOBEC3G (NP_068594.1). Percent identity by BLAST analysis: Human, Baboon (100%); Monkey (92%); Chimpanzee, Gorilla, Gibbon, Marmoset (83%). |
Goat Anti-APOBEC3G Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DEHSQDLSGRLR, from the C Terminus of the protein sequence according to NP_068594.1. |
APOBEC3G rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APOBEC3G |
APOBEC3G Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-330 of human APOBEC3G (NP_068594.1). |
Modifications | Unmodified |
APOBEC3G (Center) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This polyclonal antibody is generated from mice immunized with KLH conjugated synthetic peptides corresponding to middle region of human CEM15. |
APOBEC3G (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This polyclonal antibody is generated from mice immunized with KLH conjugated synthetic peptides corresponding to C-terminal of human CEM15. |
Rabbit Polyclonal APOBEC3G Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | APOBEC3G antibody was raised against a synthetic peptide corresponding to 15 amino acids near the amino-terminus of human APOBEC3G APOBEC3G antibody will also detect the APOBEC3F isoform. |
Rabbit Polyclonal Anti-APOBEC3G Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-APOBEC3G Antibody: synthetic peptide directed towards the N terminal of human APOBEC3G. Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC |
Goat Anti-APOBEC3G / ARP9 Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SKWRKLHRDQE, from the internal region of the protein sequence according to NP_068594.1 |