Antibodies

View as table Download

ACSL5 mouse monoclonal antibody,clone OTI3A3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI3A3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ACSL5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG

ACSL5 mouse monoclonal antibody,clone OTI3A3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated