Antibodies

Jump to Filters
View as table Download
UCHL3 Rabbit Polyclonal Antibody
TA350569

USD 380.00

In Stock

Rabbit Polyclonal Anti-UCHL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
UCHL3 Rabbit Polyclonal Antibody
TA365118

USD 380.00

4 Weeks

UCHL3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
UCHL3 Rabbit Polyclonal Antibody
TA344239

USD 539.00

5 Days

Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC