EXOSC7 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
EXOSC7 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
EXOSC7 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Biotin |
EXOSC7 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | HRP |
EXOSC7 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
EXOSC7 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EXOSC7 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
EXOSC7 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
EXOSC7 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
EXOSC7 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
EXOSC7 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-EXOSC7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD |
Rabbit Polyclonal Anti-EXOSC7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC |