Antibodies

View as table Download

IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IGF1 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Carrier-free (BSA/glycerol-free) IGF1 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-TNNI3 (Cardiac Troponin I) mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNNI3 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) TNNI3 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNNI3 mouse monoclonal antibody, clone OTI14A2 (formerly 14A2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated