NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal antibody to NR0B1 (nuclear receptor subfamily 0, group B, member 1)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 96 and 406 of NR0B1 (Uniprot ID#P51843) |
Rabbit Polyclonal anti-NR0B1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: QAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQ |
Rabbit Polyclonal Anti-NR0B1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC |
NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |