Antibodies

View as table Download

Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696)

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

Rabbit polyclonal TK (Ab-13) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S).

Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926)

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Pig, Rat, Xenopus, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259)

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Rabbit polyclonal ALPL Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ALPL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the Central region of human ALPL.

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Rabbit Polyclonal ASAH1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1.

Anti-ACADS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase, C-2 to C-3 short chain

Anti-AOX1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1

Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329)

Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327)

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications Phospho-specific