Antibodies

View as table Download

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ALDH3A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ALDH3A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the C terminal of human ALDH3A1. Synthetic peptide located within the following region: KFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRI