Antibodies

View as table Download

Rabbit Polyclonal Anti-MMP19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP19 antibody: synthetic peptide directed towards the N terminal of human MMP19. Synthetic peptide located within the following region: ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR

Rabbit Polyclonal Anti-MMP19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP19 antibody: synthetic peptide directed towards the C terminal of human MMP19. Synthetic peptide located within the following region: IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS

Rabbit polyclonal anti-MMP-19 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-19.

Anti-MMP19 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 494-508 amino acids of Human matrix metallopeptidase 19