Antibodies

View as table Download

Rabbit Polyclonal KLOTHO Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KLOTHO antibody was raised against a 16 amino acid synthetic peptide near the center of human KLOTHO.

Rabbit Polyclonal Anti-KL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS

Goat Anti-Klotho (KL) Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRDDAKYMYYLKK, from the internal region of the protein sequence according to NP_004786.2; NP_710150.1.

Rabbit Polyclonal Anti-KL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: HAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGD