Antibodies

View as table Download

Rabbit polyclonal antibody to Amphiphysin (amphiphysin)

Applications IHC, WB
Reactivities Human (Predicted: Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 194 of Amphiphysin (Uniprot ID#P49418)

Anti-AMPH Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin

Anti-AMPH Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin

Rabbit Polyclonal Anti-FCGR3A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FCGR3A

Rabbit Polyclonal Anti-GSN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN