Antibodies

Jump to Filters
View as table Download
PARL Rabbit Polyclonal Antibody
TA350266

USD 380.00

In Stock

Rabbit Polyclonal Anti-PARL Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PARL
PARL Rabbit Polyclonal Antibody
TA336006

USD 539.00

5 Days

Rabbit Polyclonal Anti-PARL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PARL Antibody: synthetic peptide directed towards the N terminal of human PARL. Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
PARL (N-term) Rabbit Polyclonal Antibody
AP23960PU-N

USD 535.00

2 Weeks

PARL (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PARL antibody was raised against a 15 amino acid peptide from near the amino terminus of human PARL.