Rabbit Polyclonal Anti-HNRNPM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNRNPM |
Rabbit Polyclonal Anti-HNRNPM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNRNPM |
Rabbit Polyclonal Anti-PRPF19 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |
Rabbit anti-PRPF31 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRPF31 |