Rabbit Polyclonal MSX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-100 of human HOX7 was used as the immunogen. |
Rabbit Polyclonal MSX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-100 of human HOX7 was used as the immunogen. |
Rabbit Polyclonal anti-MSX1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSX1 antibody: synthetic peptide directed towards the middle region of human MSX1. Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF |
MSX1 (N-term) goat polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-MSX1 Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TSLPLGVKVEDS-C, from the N Terminus of the protein sequence according to NP_002439.1. |