Antibodies

View as table Download

Rabbit Polyclonal MSX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 50-100 of human HOX7 was used as the immunogen.

Rabbit Polyclonal anti-MSX1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSX1 antibody: synthetic peptide directed towards the middle region of human MSX1. Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF

MSX1 (N-term) goat polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated

Goat Anti-MSX1 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence TSLPLGVKVEDS-C, from the N Terminus of the protein sequence according to NP_002439.1.