Rabbit Polyclonal Anti-TFAP2C Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFAP2C Antibody: synthetic peptide directed towards the middle region of human TFAP2C. Synthetic peptide located within the following region: SPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVTL |
Rabbit Polyclonal Anti-TFAP2C Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFAP2C antibody: synthetic peptide directed towards the N terminal of human TFAP2C. Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG |
Goat Anti-AP-2 gamma Antibody
| Applications | IHC |
| Reactivities | Human (Expected from sequence similarity: Rat, Mouse, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKTLEKMEKHRK, from the C Terminus of the protein sequence according to NP_003213.1. |
Germany
Japan
United Kingdom
China
