LPL (Lipoprotein lipase) mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LPL (Lipoprotein lipase) mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
Perilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant
Applications | IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP27A1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1. |
Rabbit Polyclonal Anti-ACSL3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the C-terminus of human PPARD |
Rabbit Polyclonal UCP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UCP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human UCP1 (GenBank accession. |
Rabbit Polyclonal Anti-UCP1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UCP1 |
Goat Polyclonal Antibody against SORBS1
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1. |
Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human |
Conjugation | Unconjugated |
Immunogen | C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346) |