Rabbit Polyclonal Anti-NCAM1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NCAM1 |
Rabbit Polyclonal Anti-NCAM1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NCAM1 |
Rabbit Polyclonal Anti-CLDN23 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
Rabbit Monoclonal e-cadherin Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V). |
Modifications | Phospho-specific |
CD8A rabbit monoclonal antibody, clone SP16, Supernatant
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |