Rabbit Polyclonal antibody to Glycine dehydrogenase (glycine dehydrogenase (decarboxylating))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat, Xenopus, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 442 and 723 of Glycine dehydrogenase (Uniprot ID#P23378) |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
GAD67 (GAD1) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide KLH conjugated corresponding to a region near the C-terminus of this gene product, and was 100% conserved between the Human (Q99259), Mouse (P48318) and Rat (NP_058703) gene products. After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity purified using a peptide column. |
Rabbit Polyclonal Anti-GCLM Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ |
GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Feline, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide sequence from the C-terminus of GAD |
Germany
Japan
United Kingdom
China
