Antibodies

View as table Download

Rabbit Polyclonal Anti-SDCBP Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-SDCBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

Rabbit Polyclonal Anti-SDCBP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SDCBP