Antibodies

Jump to Filters
View as table Download
BRD4 Rabbit Polyclonal Antibody
TA343731

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-BRD4 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
BRD4 Rabbit Monoclonal Antibody [Clone ID: RAB-C131]
TA386451

USD 630.00

2 Weeks

Recombinant Anti-BRD4 (Clone RAB-C131)

Applications ChIP, ELISA, FC, IF
Reactivities Human
Conjugation Unconjugated
BRD4 Human Monoclonal Antibody [Clone ID: RAB-C131]
TA386450

USD 820.00

5 Weeks

Recombinant Anti-BRD4 (Clone RAB-C131)

Applications ChIP, ELISA, FC, IF
Reactivities Human
Conjugation His Tag