Antibodies

View as table Download

CYP2A13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 306-360 of Human CYP2A13.

Cytochrome P450 3A4 (CYP3A4) (+ CYP3A5) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 351-400 of Human CYP3A4.

Cytochrome P450 2A6 (CYP2A6) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 101-150 of Human CYP2A6.

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD

HPRT1 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated