Antibodies

Jump to Filters
View as table Download
Acetyl CoA synthetase (ACSS2) Rabbit Polyclonal Antibody
AP20096AF-N

USD 330.00

2 Weeks

Acetyl CoA synthetase (ACSS2) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bakers Yeast
Conjugation Unconjugated
Immunogen Purified S-Acetyl Coenzyme A Synthetase from baker's Yeast
MDH1 Rabbit Polyclonal Antibody
AP21343AF-N

USD 330.00

2 Weeks

MDH1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Malic dehydrogenase is isolated and purified from Human erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
MDH1 Rabbit Polyclonal Antibody
AP21343PU-N

USD 705.00

2 Weeks

MDH1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Malic dehydrogenase is isolated and purified from Human erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
MDH1 Rabbit Polyclonal Antibody
AP21344AF-N

USD 330.00

2 Weeks

MDH1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Malic dehydrogenase is isolated and purified from Human placenta.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
MDH1 Rabbit Polyclonal Antibody
AP21344PU-N

USD 705.00

2 Weeks

MDH1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Malic dehydrogenase is isolated and purified from Human placenta.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
PGAM2 Sheep Polyclonal Antibody
AP21372AF-N

USD 330.00

2 Weeks

PGAM2 sheep polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Rabbit
Conjugation Unconjugated
Immunogen Phosphoglyceric mutase isolated and purified from rabbit muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure.
PGAM2 Sheep Polyclonal Antibody
AP21372PU-N

USD 705.00

2 Weeks

PGAM2 sheep polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Rabbit
Conjugation Unconjugated
Immunogen Phosphoglyceric mutase isolated and purified from rabbit muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure.
CHST6 Rabbit Polyclonal Antibody
TA312663

USD 380.00

In Stock

Rabbit polyclonal anti-CHST6 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHST6.
GAPDH Mouse Monoclonal Antibody [Clone ID: 4G5]
5G4-4G5

USD 725.00

3 Weeks

GAPDH mouse monoclonal antibody, clone 4G5

Applications ELISA, IF, WB
Reactivities Bovine, Feline, Goat, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
IMPDH2 Rabbit Polyclonal Antibody
TA336212

USD 539.00

5 Days

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD