Antibodies

View as table Download

Rabbit Polyclonal S1P1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1.

Goat Polyclonal Antibody against HCRTR1

Applications IF, WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1.

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.

Rabbit Polyclonal MC4R Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MC4R antibody was raised against a 19 amino acid peptide near the amino terminus of human MC4R.

Rabbit polyclonal CALCR Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CALCR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids from the C-terminal region of human CALCR.

Rabbit Polyclonal anti-HTR2B antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK

Rabbit polyclonal anti-VIPR2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human VIPR2.

Rabbit polyclonal anti-PE2R3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PE2R3.

FPR1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between aa 155 -204 of human FPR1.

Goat Anti-Adenosine A2b Receptor Antibody

Applications FC, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQADVKSGNGQ, from the C Terminus of the protein sequence according to NP_000667.1.

Rabbit polyclonal anti-S1PR1/EDG1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EDG1.
Modifications Phospho-specific

Rabbit polyclonal anti-NPY2R antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPY2R.

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B.