Antibodies

Jump to Filters
View as table Download
HTR2B Rabbit Polyclonal Antibody
TA329175

USD 539.00

5 Days

Rabbit Polyclonal anti-HTR2B antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
HTR2B Rabbit Polyclonal Antibody
AP01188PU-N

USD 445.00

3 Weeks

HTR2B rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 30-80 of Human SR-2B.
HTR2B Rabbit Polyclonal Antibody
TA314042

USD 380.00

4 Weeks

Rabbit polyclonal anti-5-HT-2B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2B.