Antibodies

Jump to Filters
View as table Download
DP1 (TFDP1) Rabbit Polyclonal Antibody
TA314614

USD 380.00

In Stock

Rabbit polyclonal anti-DP-1 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human DP-1.
DP1 (TFDP1) Rabbit Polyclonal Antibody
TA330086

USD 539.00

5 Days

Rabbit Polyclonal Anti-TFDP1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the N terminal of human TFDP1. Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN