Antibodies

View as table Download

Rabbit Polyclonal TrkC Antibody

Applications ICC/IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the extracellular domain of the human TrkC protein (within residues 300-400). [UniProt Q16288].

Rabbit Polyclonal Anti-NTRK3

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

Rabbit anti-NTRK3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NTRK3

Rabbit polyclonal TrkC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TrkC antibody is generated from rabbits immunized with a his tag recombinant protein of human TrkC.