Rabbit Polyclonal Anti-TPD52 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPD52 antibody: synthetic peptide directed towards the C terminal of human TPD52. Synthetic peptide located within the following region: RELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDV |
Rabbit Polyclonal Anti-TPD52 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPD52 antibody: synthetic peptide directed towards the middle region of human TPD52. Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG |
Rabbit polyclonal anti-TPD52 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TPD52. |
Rabbit Polyclonal Anti-TPD52 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TPD52 |
TPD52 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TPD52 (NP_005070.1). |
| Modifications | Unmodified |
Rabbit anti Tpd52 (Tumor Protein D52) Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human, Chicken, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of tumor protein D52 (Tpd52). This sequence is identical to mouse, rat, human, chicken and bovine origins. |
Germany
Japan
United Kingdom
China
