Rabbit Polyclonal Anti-TJP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS |
Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1574 and 1748 of ZO-1 (Uniprot ID#Q07157) |
TJP1 (alpha plus) rabbit polyclonal antibody, Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 886-995 of Human ZO-1 |
Rabbit Polyclonal Anti-ZO 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZO 1 Antibody: A synthesized peptide derived from human ZO 1 |
Tjp1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
ZO-1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1600-1700 of human ZO-1 (NP_003248.3). |
| Modifications | Unmodified |
Rabbit anti ZO-1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
