Antibodies

Jump to Filters
View as table Download
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA322296

USD 380.00

4 Weeks

Anti-ANTXR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA322295

USD 380.00

2 Weeks

Anti-ANTXR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-332 amino acids of human anthrax toxin receptor 1
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA339602

USD 539.00

5 Days

Rabbit Polyclonal Anti-ANTXR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANTXR1 antibody: synthetic peptide directed towards the middle region of human ANTXR1. Synthetic peptide located within the following region: VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK