Antibodies

Jump to Filters
View as table Download
SLFNL1 (N-term) Rabbit Polyclonal Antibody
AP53933PU-N

USD 580.00

2 Weeks

SLFNL1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 65-95 amino acids from the N-terminal region of Human SLFNL1.
SLFNL1 Rabbit Polyclonal Antibody
TA340374

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLFNL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLFNL1 antibody: synthetic peptide directed towards the middle region of human SLFNL1. Synthetic peptide located within the following region: TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL