PPP2R3B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PPP2R3B |
PPP2R3B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PPP2R3B |
PPP2R3B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 356-575 of human PPP2R3B (NP_037371.2). |
Modifications | Unmodified |
Rabbit Polyclonal Anti-PPP2R3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R3B antibody: synthetic peptide directed towards the C terminal of human PPP2R3B. Synthetic peptide located within the following region: TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETA |
Rabbit Polyclonal Anti-PPP2R3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R3B antibody: synthetic peptide directed towards the C terminal of human PPP2R3B. Synthetic peptide located within the following region: ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ |
PPP2R3B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |